« Back
Home /
GNPNAT1 Rabbit pAb

GNPNAT1 Rabbit pAb

€125.00

Excl. VAT

Item no.	A17759-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Western Blot Immunofluorescence Primary Antibodies By Organ Pancreatic Cancer Nervous System Cancer
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVED
NCBI	GNPNAT1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GNA1;GNPNAT;Gpnat1;GNPNAT1
Similar products	GNPNAT1, GNA1, GNPNAT, Gpnat1
Available
Background	Enables identical protein binding activity. Predicted to be involved in UDP-N-acetylglucosamine biosynthetic process. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in late endosome. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and endoplasmic reticulum-Golgi intermediate compartment.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GNPNAT1 (NP_932332.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	21kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling
Gene Symbol	GNPNAT1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

Listprice: €125.00

Price: €125.00

available

Delivery expected until 9/30/2025

Quantity:

Compare