« Back
Home /
Somatostatin Receptor 2 (SSTR2) Rabbit pAb

Somatostatin Receptor 2 (SSTR2) Rabbit pAb

€880.00

Excl. VAT

Item no.	A15101-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
NCBI	SSTR2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SSTR2;somatostatin receptor 2;SS 2 R;SS2R;SRIF 1;SS2 R;SRIF-1
Available
Background	Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 270-369 of human Somatostatin Receptor 2 (SSTR2) (NP_001041.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:100
Protein Size	41kDa
Manufacturers Research Area	Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Endocrine Metabolism, Neuroscience
Gene Symbol	SSTR2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

Listprice: €880.00

Price: €880.00

available

Delivery expected until 12/2/2025

Quantity:

Compare