REEP

Item no.	75-368
Manufacturer	Antibodies Incorporated
Amount	100 ul
Category	Antibodies Immunohistochemistry Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Tags, Rare Disease Markers, CounterACT, and More!
ABID	RRID:AB_2315911
Cross Reactivity	Cross-reacts with REEP1
Description	Immunogen: Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6) Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) < 40% identity with REEP1 and REEP4 but > 65% identity for first 46 amino acids (RDKSYETMMRV GKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL)
Expected Banding Pattern	30 kDa
Target	REEP
Validation	T\|Br-IB\|Br-IHC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 7/31/2025

Compare

Add to wishlist

Get an offer

Request delivery time