SVOP

Item no.	75-353
Manufacturer	Antibodies Incorporated
Amount	100 ul
Category	Neuroscience Neural Signaling Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunocytochemistry (ICC)
Category Name	Tags, Rare Disease Markers, CounterACT, and More!
ABID	RRID:AB_2315934
Cross Reactivity	Does not cross-react with SVOPL/SVOP2
Description	Immunogen: Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRV GLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7) Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)
Expected Banding Pattern	60 kDa
Target	SVOP
Validation	T\|Br-IB\|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 7/31/2025

Compare

Add to wishlist

Get an offer

Request delivery time