REEP1

€491.00

Excl. VAT

Item no.	75-313
Manufacturer	Antibodies Incorporated
Amount	100 ul
Category	Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunocytochemistry (ICC)
Category Name	Tags, Rare Disease Markers, CounterACT, and More!
ABID	RRID:AB_2315913
Cross Reactivity	Does not cross-react with REEP2
Description	Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4) Rat: 97% identity (89/91 amino acids identical) Human: 95% identity (87/91 amino acids identical) Some identity with REEP2
Expected Banding Pattern	22 kDa
Target	REEP1
Validation	T\|Br-IB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

Listprice: €491.00

Price: €491.00

available

Delivery expected until 7/31/2025

Quantity:

Compare