BAF53a

Item no.	75-330
Manufacturer	Antibodies Incorporated
Amount	100 ul
Category	Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunocytochemistry (ICC)
Category Name	Tags, Rare Disease Markers, CounterACT, and More!
ABID	RRID:AB_2315809
Cross Reactivity	Does not cross-react with BAF53b
Description	Immunogen: Fusion protein amino acids 43-119 (MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENME AISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHP, actin subdomain 2) of human BAF53a (also known as 53 kDa BRG1-associated factor A, BRG1-associated factor 53A, Actin-like protein 6A, ArpNbeta, ACTL6A, INO80 complex subunit K and INO80K, accession number O96019) Mouse: 96% identity (74/77 amino acids identical) Rat: 94% identity (73/77 amino acids identical) >50% identity with BAF53a
Expected Banding Pattern	53 kDa
Target	BAF53a
Validation	T

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 7/31/2025

Compare

Add to wishlist

Get an offer

Request delivery time