Comparison

MFF (exon 1)

Item no. 73-373
Manufacturer Antibodies Incorporated
Amount 5 mL
Category
Type Antibody Monoclonal
Applications IHC, ICC, IB
Clone N382/69
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Available
Applications info
Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name
Tags, Rare Disease Markers, CounterACT, and More!
ABID
RRID:AB_2315892
Cross Reactivity
Does not react with MFF isoforms that do not contain exon 1
Description
Immunogen:
Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8)
Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical)
Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical)
Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
Expected Banding Pattern
40 kDa
Target
MFF (exon 1)
Validation
T|Br-IB|Br-IHC|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 mL
Available: In stock
available

Delivery expected until 9/11/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close