« Back
Home /
β-Tubulin Rabbit pAb

β-Tubulin Rabbit pAb

€80.00

Excl. VAT

Item no.	AC015-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies Mikrotubules
Type	Antibody Polyclonal
Applications	WB, IF, ICC, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
NCBI	TUBB
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Background	This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.
Route	Recombinant protein
Manufacturers Category	Loading control Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human β-Tubulin (NP_006077.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	50kDa
Manufacturers Research Area	Cell Cycle, Centrosome, Cytoskeleton, Microtubules
Gene Symbol	TUBB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

Listprice: €80.00

Price: €80.00

available

Delivery expected until 9/30/2025

Quantity:

Compare