« Back
Home /
RHOT2 Rabbit pAb

RHOT2 Rabbit pAb

€370.00

Excl. VAT

Item no.	A2597-200ul
Manufacturer	Abclonal
Amount	200ul
Category	Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot Primary Antibodies small GTPases Miro Subfamily
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPA
NCBI	RHOT2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RHOT2;ARHT2;C16orf39;MIRO-2;MIRO2;RASL
Similar products	RHOT2
Available
Background	This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 340-550 of human RHOT2 (NP_620124.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	68kDa
Manufacturers Research Area	G protein signaling, Cell Biology Developmental Biology, Microtubules, Endocrine Metabolism, Mitochondrial metabolism, Mitochondrial markers
Gene Symbol	RHOT2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

Listprice: €370.00

Price: €370.00

available

Delivery expected until 9/2/2025

Quantity:

Compare