« Back
Home /
SMURF2 Rabbit pAb

SMURF2 Rabbit pAb

€100.00

Excl. VAT

Item no.	A10592-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Antibodies Cell Biology Cell Status Western Blot Senescence Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTP
NCBI	SMURF2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SMURF2
Available
Background	Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human SMURF2 (NP_073576.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:1000 - 1:2000
Protein Size	86kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Signal Transduction, Cell Biology Developmental Biology, Ubiquitin, Ubiquitin-Proteasome Signaling Pathway, TGF-b-Smad Signaling Pathway, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, Stem Cells
Gene Symbol	SMURF2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

Listprice: €100.00

Price: €100.00

available

Delivery expected until 9/30/2025

Quantity:

Compare