Comparison

SLC8A1 Rabbit pAb

€125.00
Excl. VAT
Item no. A5583-50ul
Manufacturer Abclonal
Amount 50ul
Category
Type Antibody Polyclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE
NCBI SLC8A1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias SLC8A1;NCX1
Similar products SLC8A1, NCX1, Sodium/calcium exchanger 1
Available
Background
In cardiac myocytes, Ca(2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca(2+) concentration during contraction is primarily due to release of Ca(2+) from intracellular stores. However, some Ca(2+) also enters the cell through the sarcolemma (plasma membrane). During relaxation, Ca(2+) is sequestered within the intracellular stores. To prevent overloading of intracellular stores, the Ca(2+) that entered across the sarcolemma must be extruded from the cell. The Na(+)-Ca(2+) exchanger is the primary mechanism by which the Ca(2+) is extruded from the cell during relaxation. In the heart, the exchanger may play a key role in digitalis action. The exchanger is the dominant mechanism in returning the cardiac myocyte to its resting state following excitation.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human SLC8A1 (NP_066920.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:2000 - 1:6000|IHC-P, 1:50 - 1:200
Protein Size
109kDa
Manufacturers Research Area
Cancer, Signal Transduction, Endocrine Metabolism, Neuroscience, Calcium Signaling, Cardiovascular, Hypoxia, Heart, Contractility
Gene Symbol
SLC8A1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ul
Available: In stock
Listprice: €125.00
Price: €125.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close