« Back
Home /
Musashi-1 (MSI1) Rabbit pAb

Musashi-1 (MSI1) Rabbit pAb

€125.00

Excl. VAT

Item no.	A2609-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Oncology Neuroscience Neural Lineage Markers Antibodies By Cell Type Carcinoma Western Blot Primary Antibodies By Organ Skin Cancer Adhesion Molecule Markers Cytoskeleton Markers
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	SRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
NCBI	MSI1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MSI1
Similar products	MSI1, RNA-binding protein Musashi homolog 1
Available
Background	This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 200-362 of human Musashi-1 (MSI1) (NP_002433.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:100
Protein Size	39kDa
Manufacturers Research Area	Neuroscience, Cell Type Marker, Stem Cells, Neural Stem Cells
Gene Symbol	MSI1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

Listprice: €125.00

Price: €125.00

available

Delivery expected until 9/30/2025

Quantity:

Compare