« Zurück
Startseite /
Recombinant SARS-CoV-2 Spike S1(D614G) Protein with with His tag

Recombinant SARS-CoV-2 Spike S1(D614G) Protein with with His tag

1.975,00 €

Zzgl. MwSt.

ArtNr	RP01287-1mg
Hersteller	Abclonal
Menge	1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-2
Purity	> 95% by SDS-PAGE.
Sequence	VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
NCBI	SARS-CoV-2 Spike S1(D614G)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Val16-Arg685(D614G)
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.\|or This liquid product is stable at ≤ ‑70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 Spike S1(D614G)
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4 or Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant SARS-CoV-2 Spike S1(D614G) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val16-Arg685(Asp614Gly)) of sars-cov-2 Spike S1(D614G) (Accession #QHD43416.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized recombinant SARS-CoV-2 Spike S1 at 2 μg/mL (100 μL/well) can bind recombinant Human ACE2 with a linear range of 0.03-6.26 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

Listenpreis: 1.975,00 €

Preis: 1.975,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen