« Zurück
Startseite /
Recombinant SARS-CoV-2 envelope Protein with His and Avi tag

Recombinant SARS-CoV-2 envelope Protein with His and Avi tag

1.975,00 €

Zzgl. MwSt.

ArtNr	RP01263LQ-1mg
Hersteller	Abclonal
Menge	1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-2
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
NCBI	SARS-CoV-2 Envelope
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Route	N-His&Avi
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Met1-Val75
Storage	This product is stable at ≤ -70°C for up to 6 months from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	11.4kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 Envelope
Protein Formulation	Supplied as a 0.22 μm filtered solution in 20mM Tris, 250mM NaCl, 0.5%TritonX-100, pH 8.0.Contact us for customized product form or formulation.
Protein Description	Recombinant SARS-CoV-2(2019-nCoV) Envelope Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val75) of SARS-COV-2(2019-nCoV) Envelope (Accession #QHD43418.1) fused with an initial Met, a 6×His, Avi tag at the N-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Envelope at 2 μg/mL (100 μL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

Listenpreis: 1.975,00 €

Preis: 1.975,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen