« Zurück
Startseite /
Recombinant SARS-CoV-2 Spike S1+S2 ECD(S-ECD) Protein

Recombinant SARS-CoV-2 Spike S1+S2 ECD(S-ECD) Protein

145,00 €

Zzgl. MwSt.

ArtNr	RP01260MT-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	SARS-CoV-2
Purity	> 97% by SDS-PAGE.
Sequence	CVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY
NCBI	SARS-CoV-2 Spike S1+S2 ECD(S-ECD)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Envelope,SARS-CoV-2 Spike RBD (N501Y),Spike,Spike ECD,Spike RBD,Spike S1,Spike S2,Spike S2 ECD,S1-RBD protein,NCP-CoV RBD Protein,novel coronavirus RBD Protein,2019-nCoV RBD Protein,S glycoprotein Subunit1 RBD Protein
Lieferbar
Description	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His&Avi
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Val16-Glu1188(Pro986, 987)(682-685GSAS)
Storage	Store the lyophilized protein at -20°C to -80 °C for long term.\|After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.\|or This product is stable at ≤ ‑70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	132.9kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 Spike S1+S2 ECD(S-ECD)
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant SARS-CoV-2(2019-nCoV) S1+S2 ECD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence Val16-Glu1188 of SARS-COV-2(2019-nCoV) S1+S2 ECD (Accession #QHD43416.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Spike S1+S2 ECD at 2 μg/mL (100 μL/well) can bind Recombinant Human ACE2 with a linear range of 0.15-3.03 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

Listenpreis: 145,00 €

Preis: 145,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen