Vergleich

Recombinant Cynomolgus B7-2/CD86 Protein

90,00 €
Zzgl. MwSt.
ArtNr RP00731-50ug
Hersteller Abclonal
Menge 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Monkey (Cynomolgus, Simian)
Purity > 95% by SDS-PAGE.
Sequence YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDHIP
NCBI Cynomolgus B7-2/CD86
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias T-lymphocyte activation antigen CD86 isoform 1;Activation B7-2 antigen; CD86
Lieferbar
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members aretransmembrane cell surface molecules that play important roles in immune activation and the maintenance ofimmune tolerance. It is highly expressed on activated antigen presenting cells. CD86 involved in thecostimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 orCTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, suchas deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It isexpressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosisand lysosomal degradation.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Tyr31-Pro247
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
Cynomolgus B7-2/CD86
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Cynomolgus B7-2/CD86 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr31-Pro247) of cynomolgus B7-2/CD86 (Accession #H9ZFI8) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
Listenpreis: 90,00 €
Preis: 90,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen