« Zurück
Startseite /
Recombinant Cynomolgus B7-2/CD86 Protein

Recombinant Cynomolgus B7-2/CD86 Protein

44,00 €

Zzgl. MwSt.

ArtNr	RP00731-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Monkey (Cynomolgus, Simian)
Purity	> 95% by SDS-PAGE.
Sequence	YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDHIP
NCBI	Cynomolgus B7-2/CD86
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	T-lymphocyte activation antigen CD86 isoform 1;Activation B7-2 antigen; CD86
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members aretransmembrane cell surface molecules that play important roles in immune activation and the maintenance ofimmune tolerance. It is highly expressed on activated antigen presenting cells. CD86 involved in thecostimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 orCTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, suchas deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It isexpressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosisand lysosomal degradation.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Tyr31-Pro247
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	Cynomolgus B7-2/CD86
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Cynomolgus B7-2/CD86 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr31-Pro247) of cynomolgus B7-2/CD86 (Accession #H9ZFI8) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

Listenpreis: 44,00 €

Preis: 44,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen