« Zurück
Startseite /
Recombinant Human Galectin-9/LGALS9 Protein

Recombinant Human Galectin-9/LGALS9 Protein

80,00 €

Zzgl. MwSt.

ArtNr	RP00557-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSW
NCBI	Galectin-9/LGALS9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	LGALS9,HUAT,LGALS9A
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Galectin-9 is a cytoplasmic protein that contains two galectin domains. Galectin-9 is an S-type lectin that isover-expressed in Hodgkin's disease tissue. Galectin-9 binds galactosides and has high affinity for the Forssmanpentasaccharide. Galectin-9 plays a role in thymocyte-epithelial interactions relevant to the biology of thethymus and Inhibits cell proliferation. Galectin-9 is a ligand for HAVCR2/TIM3 and induces T-helper type 1lymphocyte (Th1) death. In addition, Galectin-9 suppresses tumor cell metastasis by interfering with theassociations CD44, VCAM-1, Integrin α4β1.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Met1-Thr323
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	Galectin-9/LGALS9
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, 5% Trehalose, 1mM EDTA, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Galectin-9/LGALS9 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Met1-Thr323) of human Galectin-9/LGALS9 (Accession #Q3B8N1-2) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

Listenpreis: 80,00 €

Preis: 80,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen