FSH Recombinant Protein

This recombinant protein can be used for biological assays. For research use only.

Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days.
Aliquots of reconstituted samples are stable at -20˚ C for 3 months.

10.2 and 12.5 kD

Human Follicle-stimulating hormone (FSH) is a member of glycoprotein hormones subunit beta family, whichalso includes LH, chorionic gonadotropin (CG) and thyroid-stimulating hormone (TSH). FSH and its familymembers are heterodimers consisting of non-covalently linked alpha- and beta -subunits. They share an identical alphasubunit, and beta -subunits vary. FSH has a unique beta -subunit (FSH beta ), which confers its specific biologic activityand is responsible for interaction with the FSH-receptor which belongs to a subfamily of GPCRs calledleucine-rich-repeat-containing GPCRs (LGRs). FSH is secreted from the pituitary gland and regulatesreproduction in mammals. FSH stimulates sertoli cell proliferation in testes and supports spermatogenesis inmales, and induces the maturation of ovarian follicles in females.

CGA

Homo sapiens

Tag Free

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE