Butyrophilin 3A2 Recombinant Protein

859,00 €
Zzgl. MwSt.
ArtNr PRS-91-868-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Butyrophilin subfamily 3 member A2, BT3.2, BTF3, BTF4, BTN3A2
Lieferbar
Applications
This recombinant protein can be used for biological assays. For research use only.
Applications
This recombinant protein can be used for biological assays. For research use only.
Buffer
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days.
Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight
24.6 kD
Purity
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background
Butyrophilin subfamily 3 member A2, also known as BT3.2, BTF3, BTF4 and BTN3A2, is a single-pass type I membrane protein. It is a member of the butyrophilin (BTN) family and the immunoglobulin (IG) superfamily. BTN3A2 plays a role in T-cell responses in the adaptive immune response and inhibits the release of IFNG from activated T-cells.
Accession #
P78410
Ncbi Gene Id #
11118
Ncbi Official Symbol
BTN3A2
Ncbi Official Full Name
butyrophilin subfamily 3 member A2
Ncbi Organism
Homo sapiens
Swissprot #
P78410
Fusion Tag
C-6 His tag
Sequence
Gln30-Trp248
Peptide Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
Listenpreis: 859,00 €
Preis: 859,00 €
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen