Vergleich

IL-17 Recombinant Protein

613,00 €
Zzgl. MwSt.
ArtNr PRS-91-616-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17
Lieferbar
Applications
This recombinant protein can be used for biological assays. For research use only.
Applications
This recombinant protein can be used for biological assays. For research use only.
Buffer
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days.
Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight
20.5 kD
Purity
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background
Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.
Accession #
Q16552
Ncbi Gene Id #
3605
Ncbi Official Symbol
IL17A
Ncbi Official Full Name
interleukin 17A
Ncbi Organism
Homo sapiens
Swissprot #
Q16552
Fusion Tag
C-6 His tag
Sequence
Gly24-Ala155
Protein Gi#
767928039
Peptide Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAVDHHHHHH

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
Listenpreis: 613,00 €
Preis: 613,00 €
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen