« Zurück
Startseite /
Recombinant Human ICOS ligand(ICOSLG),partial (Active)

Recombinant Human ICOS ligand(ICOSLG),partial (Active)

216,00 €

Zzgl. MwSt.

ArtNr	CSB-MP010958HU1-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins
Format	Lyophilized powder
Specific against	Human (Homo sapiens)
Host	Mammalian cell
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B7 homolog 2 (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1)
Lieferbar
Research Areas	Cancer
Uniprot NO.	O75144
Gene Names	ICOSLG
Expression Region	19-258aa
Sequence	DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Protein Description	Partial
Tag Info	C-terminal 6xHis-tagged
Mol. Weight	28.9 kDa
Biological_Activity	Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 ug/ml can bind human ICOS (CSB-MP707478HU), the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.
Purity	Greater than 93% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Buffer	Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Relevance	Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

Listenpreis: 216,00 €

Preis: 216,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel