« Zurück
Startseite /
Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4),partial (Active)

Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4),partial (Active)

356,00 €

Zzgl. MwSt.

ArtNr	CSB-MP006163HU1-100ug
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)
Lieferbar
Gene Names	CTLA4
Expression Region	37-162aa
Sequence Info	Partial
Tag Info	C-terminal hFc-tagged
AASequence	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
MW	42.5 kDa
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml.
Activity Image Link	https://www.cusabio.com/uploadfile/protein/1/CSB-MP006163HU-AC.jpg
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance	Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

Listenpreis: 356,00 €

Preis: 356,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel