« Zurück
Startseite /
Recombinant Human Protein DGCR6L(DGCR6L)

Recombinant Human Protein DGCR6L(DGCR6L)

213,00 €

Zzgl. MwSt.

ArtNr	CSB-EP880133HU-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Head & Neck Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cell Biology
Uniprot ID	Q9BY27
Gene Names	DGCR6L
Organism	Homo sapiens (Human)
AA Sequence	MERYAAALEEVADGARQQERHYQLLSALQSLVKEL PSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQ ACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK IILELDRKVADQQSTLEKAGVAGFYVTTNPQELML QMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ CDQKGSPVPP
Expression Region	1-220aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	40.9 kDa
Alternative Name(s)	DiGeorge syndrome critical region 6-like protein
Relevance	May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.
Reference	Two functional copies of the DGCR6 gene are present on human chromosome 22q11 due to a duplication of an ancestral locus.Edelmann L., Stankiewicz P., Spiteri E., Pandita R.K., Shaffer L., Lupski J., Morrow B.E.Genome Res. 11:208-217(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.
Subcellular Location	Nucleus
Protein Families	Gonadal family
Tissue Specificity	Widely expressed in fetal and adult tissues. Highest expression in liver, heart and skeletal muscle. Lower levels in pancreas and placenta. Weak expression in brain.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

Listenpreis: 213,00 €

Preis: 213,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel