« Zurück
Startseite /
Recombinant Human Tissue-type plasminogen activator(PLAT),partial

Recombinant Human Tissue-type plasminogen activator(PLAT),partial

213,00 €

Zzgl. MwSt.

ArtNr	CSB-EP018120HU(A5)-20
Hersteller	Cusabio
Menge	20ug
Kategorie	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Cancer
Uniprot ID	P00750
Gene Names	PLAT
Organism	Homo sapiens (Human)
AA Sequence	GLFADIASHPWQAAIFAKHRRSPGERFLCGGILIS SCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEE EQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR CAQESSVVRTVCLPPADLQLPDWTECELSGYGKHE ALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTD NMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDG RMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWI
Expression Region	314-556aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	43.1 kDa
Alternative Name(s)	INN: AlteplaseINN: Reteplase
Relevance	Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue rodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration.
Reference	Cloning and expression of human tissue-type plasminogen activator cDNA in E. coli.Pennica D., Holmes W.E., Kohr W.J., Harkins R.N., Vehar G.A., Ward C.A., Bennett W.F., Yelverton E., Seeburg P.H., Heyneker H.L., Goeddel D.V., Collen D.Nature 301:214-221(1983)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration.
Involvement in disease	Increased activity of TPA results in increased fibrinolysis of fibrin blood clots that is associated with excessive bleeding. Defective release of TPA results in hypofibrinolysis that can lead to thrombosis or embolism.
Subcellular Location	Secreted, extracellular space
Protein Families	Peptidase S1 family
Tissue Specificity	Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk.
Paythway	Complementandcoagulationcascades

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

Listenpreis: 213,00 €

Preis: 213,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel