Vergleich

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

262,00 €
Zzgl. MwSt.
ArtNr BOS-RCOV02
Hersteller Boster
Menge 100ug/vial
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host E.coli
Konjugat/Tag HIS
Sequence AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8, Nonstructural Protein 8
Lieferbar
Manufacturers Product Category
Recombinant Proteins
Short Description
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only.
Description
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.
Background
Coronaviruses (CoV) are a family of large and enveloped positive-sense single-stranded RNA viruses that are classified into four genera, the alpha, beta, gamma, and delta coronaviruses. While gamma and delta coronaviruses mainly infect birds, alpha and beta coronaviruses are known to infect mammals and cause human respiratory illnesses such as the common cold, pneumonia, and severe diseases like SARS, MERS, and COVID-19. Coronavirus nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. Coronavirus N protein is required for coronavirus RNA synthesis, and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is the most abundant protein of coronavirus. During virion assembly, the N protein binds to viral RNA and leads to the formation of the helical nucleocapsid. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of the conservation of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool.
Contents
Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Purification
> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Method of purification: Nickel column affinity purification
Storage
The product is shipped at ambient temperature. Upon receipt, store it immediately at -20˚C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Molecular Weight
22.7KD

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100ug/vial
Lieferbar: In stock
Listenpreis: 262,00 €
Preis: 262,00 €
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen