Vergleich

Recombinant Mouse c-kit/CD117 Protein

59,00 €
Zzgl. MwSt.
ArtNr RP01519-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLT
NCBI c-kit/CD117
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD117,SCFR,c-Kit,KIT,Ssm,SCO1,SCO5,SOW3,Tr-kit
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
C-Kit is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). c-Kit contains 5 Ig-like C2-type (immunoglobulin-like) domains and 1 protein kinase domain. It belongs to the protein kinase superfamily, tyr protein kinase family, and CSF-1/PDGF receptor subfamily. C-Kit contains 5 Ig-like C2-type (immunoglobulin-like) domains and 1 protein kinase domain. C-Kit has tyrosine-protein kinase activity. Binding of the ligands leads to the autophosphorylation of KIT and its association with substrates such as phosphatidylinositol 3-kinase. Antibodies to c-Kit are widely used in immunohistochemistry to help distinguish particular types of tumor in histological tissue sections. It is used primarily in the diagnosis of GISTs. In GISTs, c-Kit staining is typically cytoplasmic, with stronger accentuation along the cell membranes. C-Kit antibodies can also be used in the diagnosis of mast cell tumors and in distinguishing seminomas from embryonal carcinomas. Mutations in the c-Kit gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Defects in KIT are a cause of acute myelogenous leukemia (AML). AML is a malignant disease in which hematopoietic precursors are arrested in an early stage of development. Note=Somatic mutations that lead to constitutive activation of KIT are detected in AML patients.
Route
C-raFc
Manufacturers Category
Proteins
Endotoxin
<0.1EU/μg
Immunogen
Ser25-Thr523
Storage
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Other Recombinant Protein
Gene Symbol
c-kit/CD117
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
Recombinant Mouse CD117/c-kit Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser25-Thr523) of mouse CD117/c-kit (Accession #NP_001116205.1) fused with a raFc tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
Listenpreis: 59,00 €
Preis: 59,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen