« Zurück
Startseite /
TROY/TNFRSF19 Rabbit mAb

TROY/TNFRSF19 Rabbit mAb

2.340,00 €

Zzgl. MwSt.

ArtNr	A19235-1000uL
Hersteller	Abclonal
Menge	1000 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
NCBI	TNFRSF19
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	TNFRSF19; TAJ; TAJ-alpha; TRADE; TROY; TNF receptor superfamily member 19
Lieferbar
Background	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	46kDa
Manufacturers Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Growth factors, Immunology Inflammation, NF-kB Signaling Pathway, Neuroscience
Gene Symbol	TNFRSF19

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

Listenpreis: 2.340,00 €

Preis: 2.340,00 €

lieferbar

Lieferung vsl. bis 02.12.2025

Anzahl:

Vergleichen