« Zurück
Startseite /
Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb

Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb

880,00 €

Zzgl. MwSt.

ArtNr	A16225-500uL
Hersteller	Abclonal
Menge	500 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NCBI	CSNK1A1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CSNK1A1;CK1;CK1a;CKIa;HEL-S-77p;HLCDGP1;PRO2975
Lieferbar
Background	Enables protein serine/threonine kinase activity. Involved in several processes, including negative regulation of canonical Wnt signaling pathway; peptidyl-serine phosphorylation; and positive regulation of proteasomal ubiquitin-dependent protein catabolic process. Located in centrosome; cytosol; and nuclear speck. Part of beta-catenin destruction complex. Colocalizes with keratin filament and mRNA cleavage and polyadenylation specificity factor complex. Biomarker of Alzheimer's disease and inclusion body myositis.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (CSNK1A1) (NP_001883.4).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	39kDa
Manufacturers Research Area	Signal Transduction, Kinase, Serine threonine kinases, Cell Biology Developmental Biology, Wnt ��-Catenin Signaling Pathway, Stem Cells
Gene Symbol	CSNK1A1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

Listenpreis: 880,00 €

Preis: 880,00 €

lieferbar

Lieferung vsl. bis 02.12.2025

Anzahl:

Vergleichen