MIP-3α/CCL20, Human

2.340,00 €

Zzgl. MwSt.

ArtNr	Z02842-1
Hersteller	GenScript
Menge	1 mg
Kategorie	Oncology Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Migration & Invasion By Organ Lung Cancer Bone Cancer
Typ	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human (Homo sapiens)
Purity	>97% by SDS-PAGE and HPLC analyses.
Sequence	ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02842-MIP-3_alpha_CCL20_Human, MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.</td></tr><tr><th>M.W.</th><td colspan="7"> 8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuMIP-3CCL20 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 20 ng/ml, corresponding to a specific activity of &
Similar products	MIP-3
Lieferbar
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 20 ng/ml, corresponding to a specific activity of ＞, 5.0 x 104 IU/mg.
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 20 ng/ml, corresponding to a specific activity of ＞, 5.0 x 104 IU/mg.
Description	MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.
Endotoxin Level	Less than 0.2EU/ug of rHuMIP-3CCL20 as determined by LAL method.
Formulation	Lyophilized from a 0.2µ, m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
M.W.	8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Storage	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Manufacturers Category	Proteins
Manufacturers Product Line	Chemokines
Product Origin	USA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Z02842-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

Listenpreis: 2.340,00 €

Preis: 2.340,00 €

lieferbar

Lieferung vsl. bis 14.08.2025

Anzahl:

Vergleichen