« Zurück
Startseite /
Recombinant Erythrina caffra Trypsin inhibitor DE-3

Recombinant Erythrina caffra Trypsin inhibitor DE-3

1.398,00 €

Zzgl. MwSt.

ArtNr	CSB-YP362840EGO-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Erythrina caffra (Kaffir tree) (Coastal coral tree)
Uniprot ID	P09943
AA Sequence	VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTG EETCPLTVVQSPNELSDGKPIRIESRLRSAFIPDD DKVRIGFAYAPKCAPSPWWTVVEDEQEGLSVKLSE DESTQFDYPFKFEQVSDQLHSYKLLYCEGKHEKCA SIGINRDQKGYRRLVVTEDYPLTVVLKKDESS
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-172aa
Protein Length	Full Length
MW	21.3 kDa
Relevance	Inhibition of trypsin.
Reference	The primary structure of the inhibitor of tissue plasminogen activator found in the seeds of Erythrina caffra.Joubert F.J., Dowdle E.B.D.Thromb. Haemost. 57:356-360(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibition of trypsin.
Protein Families	Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP362840EGO-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

Listenpreis: 1.398,00 €

Preis: 1.398,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel