« Zurück
Startseite /
Recombinant Pig Complement C5a anaphylatoxin(C5)

Recombinant Pig Complement C5a anaphylatoxin(C5)

1.398,00 €

Zzgl. MwSt.

ArtNr	CSB-YP003995PI-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Oncology Food Safety Histamines Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins By Organ Skin Cancer
Typ	Proteins Recombinant
Specific against	Porcine
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Target / Protein	C5
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Sus scrofa (Pig)
Uniprot ID	P01032
AA Sequence	MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCE ERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNI QLGR
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-74aa
Protein Length	Full Length
MW	10.6 kDa
Relevance	Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Reference	Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.Williamson M.P., Madison V.S.Biochemistry 29:2895-2905(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Subcellular Location	Secreted

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

Listenpreis: 1.398,00 €

Preis: 1.398,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel