« Zurück
Startseite /
Recombinant Staphylococcus aureus Tetracycline resistance protein tetM(tetM),partial

Recombinant Staphylococcus aureus Tetracycline resistance protein tetM(tetM),partial

1.783,00 €

Zzgl. MwSt.

ArtNr	CSB-EP687481FKZ-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Uniprot ID	Q53770
Gene Names	tetM
Organism	Staphylococcus aureus
AA Sequence	MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGS VDKGTTRTDNTLLERQRGITIQTGITSFQWENTKV NIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFV QAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTV YQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQW DTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQN CSLFPLYHGSAKSNIGIDNLIEVITNKFYSST
Expression Region	1-242aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	32.1 kDa
Alternative Name(s)	tetA(M)
Relevance	Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Reference	Cloning and nucleotide sequence of a chromosomally encoded tetracycline resistance determinant, tetA(M), from a pathogenic, methicillin-resistant strain of Staphylococcus aureus. Nesin M., Svec P., Lupski J.R., Godson G.N., Kreiswirth B., Projan S.J. Antimicrob. Agents Chemother. 34:2273-2276(1990)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Protein Families	TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, TetM/TetO subfamily

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

Listenpreis: 1.783,00 €

Preis: 1.783,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel