« Zurück
Startseite /
Recombinant Escherichia coli Penicillin-binding protein 1B(mrcB),partial

Recombinant Escherichia coli Penicillin-binding protein 1B(mrcB),partial

1.783,00 €

Zzgl. MwSt.

ArtNr	CSB-EP355902ENV-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Target / Protein	mrcB
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Escherichia coli (strain K12)
Uniprot ID	P02919
AA Sequence	SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVD RFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAK PATYLTALSQPKIYRLNTWIADAPIALRQPNGQVW SPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMA LGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTP IEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQ SFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGA KYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWV GRDNNQPTKLYGA
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	444-736aa
Protein Length	Partial
MW	38.6 kDa
Alternative Name(s)	Murein polymerase pbpF, ponB
Relevance	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Reference	The nucleotide sequences of the ponA and ponB genes encoding penicillin-binding protein 1A and 1B of Escherichia coli K12. Broome-Smith J.K., Edelman A., Yousif S., Spratt B.G. Eur. J. Biochem. 147:437-446(1985)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Subcellular Location	Cell inner membrane, Single-pass type II membrane protein
Protein Families	Glycosyltransferase 51 family; Transpeptidase family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

Listenpreis: 1.783,00 €

Preis: 1.783,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel