« Zurück
Startseite /
Recombinant Serratia marcescens Metallo-beta-lactamase type 2

Recombinant Serratia marcescens Metallo-beta-lactamase type 2

1.783,00 €

Zzgl. MwSt.

ArtNr	CSB-EP346782SYN-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B2 metallo-beta-lactamaseCurated,BLA-IMP
Lieferbar
Research Topic	Others
Uniprot ID	P52699
Gene Names	N/A
Organism	Serratia marcescens
AA Sequence	ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGL VVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIK GSISSHFHSDSTGGIEWLNSRSIPTYASELTNELL KKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTP DNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAW PKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLE QAVKGLNESKKPSKPSN
Expression Region	19-246aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
MW	45 kDa
Alternative Name(s)	B2 metallo-beta-lactamaseCurated BLA-IMP
Relevance	Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring.
Reference	"Molecular characterization of an enterobacterial metallo beta-lactamase found in a clinical isolate of Serratia marcescens that shows imipenem resistance."Osano E., Arakawa Y., Wacharotayankun R., Ohta M., Horii T., Ito H., Yoshimura F., Kato N.Antimicrob. AgentsChemother. 38:71-78(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring.
Subcellular Location	Periplasm
Protein Families	Metallo-beta-lactamase superfamily, Class-B beta-lactamase family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

Listenpreis: 1.783,00 €

Preis: 1.783,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel