« Zurück
Startseite /
Recombinant Human Interleukin-8(CXCL8) (Active)

Recombinant Human Interleukin-8(CXCL8) (Active)

3.034,00 €

Zzgl. MwSt.

ArtNr	CSB-AP004641HU-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Classification	Cytokine
Subdivision	Interleukin
Research Areas	Immunology
Uniprot NO.	P10145
Gene Names	CXCL8
Source	Mammalian cell
Expression Region	21-99aa
Sequence	EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVI ESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE KFLKRAENS
Protein Description	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Mol. Weight	10.1 kDa
Biological Activity	The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 25 ng/mL.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias	Interleukin-8; IL-8; C-X-C Motif Chemokine 8; CXCL8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1
Relevance	Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular Location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

Listenpreis: 3.034,00 €

Preis: 3.034,00 €

lieferbar

Anzahl:

Vergleichen

Auf den Wunschzettel