Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)

Others

Not Test

Bovine coronavirus (strain Mebus) (BCoV) (BCV)

FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPR NYSYMDLNPALCDSGKISSKAGNSIFRSFHFTDFY NYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWM QNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQS TALCKSGSLVLNNPAYIAREANFGDYYYKVEADFY LSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKD TGVIYGLNSTETITTGFDFNCHYLVLPSGNYLAIS NELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQ SDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAG FTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSY GRCPTAADINTPDVPICVYDPLPLILLGILLGVAV IIIVVLLLYFMVDNGTRLHDA

19-424aa

47.7 kDa

Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. Ses to be a 'luxury' protein that is not absolutely necessary for virus infection in culture. However, its presence in the virus may alter its pathogenicity. May become a target for both the humoral and the cellular branches of the immune syst.

Greater than 90% as determined by SDS-PAGE.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. Seems to be a 'luxury' protein that is not absolutely necessary for virus infection in culture. However, its presence in the virus may alter its pathogenicity. May become a target for both the humoral and the cellular branches of the immune system.

Influenza type C/coronaviruses hemagglutinin-esterase family