« Zurück
Startseite /
Butyrophilin 3A2 Recombinant Protein

Butyrophilin 3A2 Recombinant Protein

859,00 €

Zzgl. MwSt.

ArtNr	PRS-91-868-0.05mg
Hersteller	ProSci
Menge	0.05 mg
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Butyrophilins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Butyrophilin subfamily 3 member A2, BT3.2, BTF3, BTF4, BTN3A2
Lieferbar
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions	Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	24.6 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Butyrophilin subfamily 3 member A2, also known as BT3.2, BTF3, BTF4 and BTN3A2, is a single-pass type I membrane protein. It is a member of the butyrophilin (BTN) family and the immunoglobulin (IG) superfamily. BTN3A2 plays a role in T-cell responses in the adaptive immune response and inhibits the release of IFNG from activated T-cells.
Accession #	P78410
Ncbi Gene Id #	11118
Ncbi Official Symbol	BTN3A2
Ncbi Official Full Name	butyrophilin subfamily 3 member A2
Ncbi Organism	Homo sapiens
Swissprot #	P78410
Fusion Tag	C-6 His tag
Sequence	Gln30-Trp248
Peptide Sequence	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

Listenpreis: 859,00 €

Preis: 859,00 €

lieferbar

Lieferung vsl. bis 04.09.2025

Anzahl:

Vergleichen