Recombinant Mouse Interleukin-17A (Il17a), partial (Active)

Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17

Mammalian cell

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNS LGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSV IWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLK REPESCPFTFRVEKMLVGVGCTCVASIVRQAA

C-terminal 6xHis-tagged

>95% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Mature mouse IL-17A shares 61% and 89% amino acid sequence identity with human and rat IL-17A, respectively. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.

Secreted

Restricted to a subset of activated T-cells.