Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial (Active)

Interleukin-20 Receptor Subunit Alpha, IL-20 Receptor Subunit Alpha, IL-20R-Alpha, IL-20RA, Cytokine Receptor Class-II Member 8, Cytokine Receptor Family 2 Member 8, CRF2-8, IL-20R1, ZcytoR7, IL20RA

Mammalian cell

VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQG VKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSA ETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLE TQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLP VSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLV LTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCART LKDQSSEFKAK

C-terminal 6xHis-tagged

>95% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

Interleukin-20 Receptor Subunit alpha (IL20RA) is a single-pass type I membrane protein that is a member of the type II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29 amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24 amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed with highest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, and the complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique and specific receptor IL10RB and functions as the receptor for IL26.

Membrane, Single-pass type I membrane protein

Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.