SUR1

491,00 €

Zzgl. MwSt.

ArtNr	75-267
Hersteller	Antibodies Incorporated
Menge	100 uL
Kategorie	Antibodies Immunohistochemistry Immunocytochemistry Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Applikationen	IHC, ICC, IB
Clon	N289/16
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Hamster
Host	Mouse
Isotype	IgG1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Lieferbar
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Receptors
ABID	RRID:AB_11001558
Cross Reactivity	Does not cross-react with SUR2B (based on KO validation results)
Description	Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS, ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429) Mouse: 100% identity (35/35 amino acids identical) Human: 94% identity (33/35 amino acids identical) Similar % identity with other isoforms >70% identity with SUR2B
Expected Banding Pattern	180 kDa
Target	SUR1
Validation	T\|Br-IB\|Br-IHC\|KO

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

Listenpreis: 491,00 €

Preis: 491,00 €

lieferbar

Lieferung vsl. bis 11.09.2025

Anzahl:

Vergleichen