SUR2B

ArtNr	73-399
Hersteller	Antibodies Incorporated
Menge	5 mL
Kategorie	Antibodies Immunohistochemistry Immunocytochemistry Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Applikationen	IHC, ICC, IB
Clon	N323B/20
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG2b
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Lieferbar
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Receptors
ABID	RRID:AB_2341102
Cross Reactivity	Does not cross-react with SUR1
Description	Immunogen: Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATPbinding cassette transporter sub-family C member 9B and Abcc9B, accession number Q63563-2) Mouse: 100% identity (43/43 amino acids identical) Human: 97% identity (42/43 amino acids identical) No identity with SUR2A > 75% identity with SUR1
Expected Banding Pattern	175 kDa (and smaller fragments likely due to proteolytic cleavage)
Target	SUR2B
Validation	T\|Br-IB\|Br-IHC

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 mL

lieferbar

Lieferung vsl. bis 11.09.2025