MFF

ArtNr	73-366
Hersteller	Antibodies Incorporated
Menge	5 mL
Kategorie	Antibodies Immunohistochemistry Immunocytochemistry Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Applikationen	IHC, ICC, IB
Clon	N382/14
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Lieferbar
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Tags, Rare Disease Markers, CounterACT, and More!
ABID	RRID:AB_2315890
Description	Immunogen: Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8) Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical) Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical) Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
Expected Banding Pattern	40 kDa
Target	MFF
Validation	T\|Br-IB\|Br-IHC\|KO

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 mL

lieferbar

Lieferung vsl. bis 11.09.2025