« Zurück
Startseite /
Recombinant Mouse VEGF 164 Protein

Recombinant Mouse VEGF 164 Protein

70,00 €

Zzgl. MwSt.

ArtNr	RP01060-20ug
Hersteller	Abclonal
Menge	20 ug
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Adenocarcinoma By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NCBI	VEGF-A/VEGF164
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MVCD1, VEGFA, VEGF, VPF
Similar products	VEGF, VEGFA, VPF, MVCD1
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Ala27-Arg190
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor, Cell Culture related
Gene Symbol	VEGF-A/VEGF164
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse VEGF-A/VEGF164 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala27-Arg190) of mouse VEGF 164 (Accession #NP_001273986.1.) fused with a 6×His tag at the N-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse VEGF164 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 8-30 ng/mL.\|2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED₅₀ for this effect is typically 0.006-0.022 ng/mL, corresponding to a specific activity of 4.54×10⁷-1.67×10⁸units/mg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

Listenpreis: 70,00 €

Preis: 70,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen