« Zurück
Startseite /
Recombinant human FAP Protein

Recombinant human FAP Protein

105,00 €

Zzgl. MwSt.

ArtNr	RP01252LQ-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism By Cell Type Carcinoma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Enzymes Other Fatty Acid Enzymes
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	RPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVP
NCBI	Prolyl endopeptidase FAP
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DPPIV, DPPIVA, FAPA, Fibroblast Activation Protein alpha, SIMP
Similar products	FAPA, DPPIV, SIMP, DPPIVA, Fibroblast Activation Protein alpha
Lieferbar
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Arg27-Asp760
Storage	This product is stable at ≤ ‑70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Manufacturers Research Area	Biosimilar Drug Targets
Gene Symbol	Prolyl endopeptidase FAP
Protein Formulation	Supplied as a 0.22 μm filtered solution in 16mM Tris, 240mM Nacl and 20% glycerol, pH7.5.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Prolyl endopeptidase FAP Protein is produced by Baculovirus-Infected Sf9 Cells expression system. The target protein is expressed with sequence (Arg27-Asp760) of human FAP (Accession #NP_004451.2) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Human FAP at 1 μg/mL (100 μL/well) can bind FAP Rabbit mAb with a linear range of 0.03-1.77 ng/mL.\|2.Measured by its ability to convert the substrate benzyloxycarbonyl-Gly-Pro-7-amido-4-methylcoumarin (Z-GP-AMC) to Z-Gly-Pro and 7-amino-4-methylcoumarin (AMC).The specific activity is >2314 pmol/min/μg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01252LQ-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

Listenpreis: 105,00 €

Preis: 105,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen