« Zurück
Startseite /
Recombinant human GTPase KRas/KRAS Protein

Recombinant human GTPase KRas/KRAS Protein

80,00 €

Zzgl. MwSt.

ArtNr	RP01239-20ug
Hersteller	Abclonal
Menge	20 ug
Kategorie	Oncology By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Adenocarcinoma Cytoskeleton By Organ Lung Cancer Colorectal Cancer small GTPases Ras Subfamily
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 85% by SDS-PAGE.
Sequence	TEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKC
NCBI	GTPase KRas/KRAS(G12V)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS, NS3, RALD, RASK2
Similar products	KRAS2, RASK2, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, NS, NS3, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, CFC2, RALD
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Thr2-Cys186(G12V)
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	GTPase KRas/KRAS(G12V)
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human GTPase KRas/KRAS(G12V) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr2-Cys186(Gly12Val)) of human GTPase KRas/KRAS (Accession #NP_203524.1) fused with a 6×His tag at the N-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human KRAS, His Tag at 2 μg/mL (100 μL/well) can bind Anti-KRAS Ab with a linear range of 42-84.56 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

Listenpreis: 80,00 €

Preis: 80,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen