« Zurück
Startseite /
Recombinant human VEGFR1/Flt-1 Protein

Recombinant human VEGFR1/Flt-1 Protein

46,00 €

Zzgl. MwSt.

ArtNr	RP01188-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Oncology Neuroscience Neural Development By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines Adenocarcinoma By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTAT
NCBI	FLT-1/VEGFR-1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	VEGFR-1, VEGFR1, FLT-1, FLT, FRT
Similar products	VEGFR1, VEGFR-1, FLT, FLT-1, FRT
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Met1-Asn756
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor, Biosimilar Drug Targets
Gene Symbol	FLT-1/VEGFR-1
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human FLT-1/VEGFR-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asn756) of human VEGFR1/Flt-1 (Accession #NP_002010.1) fused with a 8×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGFR1 at 500 ng/mL (100 μL/well) can bind Recombinant Mouse PLGF with a linear range of 12-49 ng/mL.\|2.Measured by its ability to inhibit the VEGF-dependent proliferation of HUVEC human umbilical vein endothelial cells. Conn, G. et al. (1990) Proc. Natl. Acad. Sci. USA 87:1323. The ED₅₀ for this effect is 0.039-0.154 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

Listenpreis: 46,00 €

Preis: 46,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen