Vergleich

Recombinant human Nectin-1/PVRL1/CD111 Protein

54,00 €
Zzgl. MwSt.
ArtNr RP01066-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFD
NCBI Nectin-1/PVRL1/CD111
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PVRL1, Nectin-1, CD111, CLPED1, ED4, HIgR, HVEC, OFC7, PRR, PRR1, PVRR, PVRR1, SK-12
Similar products PVRL1, PRR1, PRR, CD111, CLPED1, ED4, HIgR, HVEC, OFC7, PVRR, PVRR1, SK-12, Nectin-1
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route
C-hFc&His
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Met1-Thr334
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint, Bio-Markers & CD Antigens
Gene Symbol
Nectin-1/PVRL1/CD111
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Human Nectin-1/PVRL1/CD111 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Thr334) of human Nectin-1/PVRL1/CD111 (Accession #NP_002846.3) fused with an Fc, 6×His tag at the C-terminus.
Protein Bio Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Nectin-3 at 2 μg/mL (100 μL/well) can bind Recombinant human Nectin-1 with a linear range of 30-122 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
Listenpreis: 54,00 €
Preis: 54,00 €
lieferbar

Lieferung vsl. bis 02.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen