« Zurück
Startseite /
Recombinant Human CD99 Protein

Recombinant Human CD99 Protein

90,00 €

Zzgl. MwSt.

ArtNr	RP01050-20ug
Hersteller	Abclonal
Menge	20 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Bone Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 85% by SDS-PAGE.
Sequence	DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
NCBI	12E7/CD99
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, 12E7
Similar products	CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, 12E7
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-hFc&His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Asp23-Asp122
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Bio-Markers & CD Antigens
Gene Symbol	12E7/CD99
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human 12E7/CD99 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp23-Asp122) of human CD99 (Accession #NP_002405.1.) fused with an Fc, 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA.Immobilized PE anti-human CD99 Antibody at 1μg/mL (100 μL/well) can bind Human CD99 with a linear range of 0.46-9.4 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

Listenpreis: 90,00 €

Preis: 90,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen