Vergleich

Recombinant Human Ephrin A3 Protein

145,00 €
Zzgl. MwSt.
ArtNr RP01022-100ug
Hersteller Abclonal
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
NCBI Ephrin-A3/EFNA3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EFL2, Ehk1-L, EPLG3, LERK3
Similar products EFL2, EPLG3, Ehk1-L, LERK3
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route
C-hFc&His
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Met1-Ser213
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Other Recombinant Protein
Gene Symbol
Ephrin-A3/EFNA3
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin A3 (Accession #NP_004943.1) fused with an Fc, 6×His tag at the C-terminus.
Protein Bio Activity
1.Measured by its binding ability in a functional ELISA. Immobilized Mouse EPHA6 at 1 μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0.3-113.9 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized Mouse EPHA6 at 1μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0.3-59 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
Listenpreis: 145,00 €
Preis: 145,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen